Lineage for d2g1jb_ (2g1j B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2109815Family c.37.1.2: Shikimate kinase (AroK) [52566] (2 protein domains)
    similar to the nucleotide/nucleoside kinases but acts on different substrate
    automatically mapped to Pfam PF01202
  6. 2109816Protein Shikimate kinase (AroK) [52567] (4 species)
  7. 2109830Species Mycobacterium tuberculosis [TaxId:1773] [75194] (11 PDB entries)
    Uniprot P95014
  8. 2109834Domain d2g1jb_: 2g1j B: [134518]
    automated match to d1l4ua_
    complexed with so4

Details for d2g1jb_

PDB Entry: 2g1j (more details), 2 Å

PDB Description: Crystal structure of Mycobacterium tuberculosis Shikimate Kinase at 2.0 angstrom resolution
PDB Compounds: (B:) Shikimate kinase

SCOPe Domain Sequences for d2g1jb_:

Sequence, based on SEQRES records: (download)

>d2g1jb_ c.37.1.2 (B:) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]}
apkavlvglpgsgkstigrrlakalgvglldtdvaieqrtgrsiadifatdgeqefrrie
edvvraaladhdgvlslgggavtspgvraalaghtvvyleisaaegvrrtggntvrplla
gpdraekyralmakraplyrrvatmrvdtnrrnpgavvrhilsrlq

Sequence, based on observed residues (ATOM records): (download)

>d2g1jb_ c.37.1.2 (B:) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]}
apkavlvglpgsgkstigrrlakalgvglldtdvaieqrtgrsiadifatdgeqefrrie
edvvraaladhdgvlslgggavtspgvraalaghtvvyleisaaegvrrtggagpdraek
yralmakraplyrrvatmrvdtnrrnpgavvrhilsrlq

SCOPe Domain Coordinates for d2g1jb_:

Click to download the PDB-style file with coordinates for d2g1jb_.
(The format of our PDB-style files is described here.)

Timeline for d2g1jb_: