SCOPe 2.06: Domain d2g1da1: 2g1d A:1-98

Lineage for d2g1da1 (2g1d A:1-98)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
   beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243

4. Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families)

5. Family d.12.1.3: Ribosomal protein S24e [117786] (1 protein)
   Pfam PF01282

6. Protein Ribosomal protein S24e [117787] (4 species)

7. Species Thermoplasma acidophilum [TaxId:2303] [142894] (1 PDB entry)
   Uniprot Q9HJ79 1-98

8. Domain d2g1da1: 2g1d A:1-98 [134516]

Details for d2g1da1

PDB Entry: 2g1d

PDB Description: solution structure of ribosomal protein s24e from thermoplasma acidophilum

PDB Compounds: (A:) 30S ribosomal protein S24e

SCOPe Domain Sequences for d2g1da1:

Sequence; same for both SEQRES and ATOM records:

>d2g1da1 d.12.1.3 (A:1-98) Ribosomal protein S24e {Thermoplasma acidophilum [TaxId: 2303]}
mdliikekrdnpilkrkeikyvlkfdssrtpsreeikeliakhegvdkelvivdnnkqlt
gkheiegytkiyadkpsamlyepdyelirnglkqkeak

Timeline for d2g1da1:

• d2g1da1 first appeared in SCOP 1.73
  
• d2g1da1 appears in SCOPe 2.05
  
• d2g1da1 appears in SCOPe 2.07
  
• d2g1da1 appears in the current release, SCOPe 2.08