![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily) beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243 |
![]() | Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) ![]() |
![]() | Family d.12.1.3: Ribosomal protein S24e [117786] (1 protein) Pfam PF01282 |
![]() | Protein Ribosomal protein S24e [117787] (4 species) |
![]() | Species Thermoplasma acidophilum [TaxId:2303] [142894] (1 PDB entry) Uniprot Q9HJ79 1-98 |
![]() | Domain d2g1da1: 2g1d A:1-98 [134516] |
PDB Entry: 2g1d (more details)
SCOPe Domain Sequences for d2g1da1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g1da1 d.12.1.3 (A:1-98) Ribosomal protein S24e {Thermoplasma acidophilum [TaxId: 2303]} mdliikekrdnpilkrkeikyvlkfdssrtpsreeikeliakhegvdkelvivdnnkqlt gkheiegytkiyadkpsamlyepdyelirnglkqkeak
Timeline for d2g1da1: