Lineage for d2g1da1 (2g1d A:1-98)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2156959Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
    beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243
  4. 2156960Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) (S)
  5. 2157117Family d.12.1.3: Ribosomal protein S24e [117786] (1 protein)
    Pfam PF01282
  6. 2157118Protein Ribosomal protein S24e [117787] (4 species)
  7. 2157126Species Thermoplasma acidophilum [TaxId:2303] [142894] (1 PDB entry)
    Uniprot Q9HJ79 1-98
  8. 2157127Domain d2g1da1: 2g1d A:1-98 [134516]

Details for d2g1da1

PDB Entry: 2g1d (more details)

PDB Description: Solution Structure of Ribosomal Protein S24E from Thermoplasma acidophilum
PDB Compounds: (A:) 30S ribosomal protein S24e

SCOPe Domain Sequences for d2g1da1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g1da1 d.12.1.3 (A:1-98) Ribosomal protein S24e {Thermoplasma acidophilum [TaxId: 2303]}
mdliikekrdnpilkrkeikyvlkfdssrtpsreeikeliakhegvdkelvivdnnkqlt
gkheiegytkiyadkpsamlyepdyelirnglkqkeak

SCOPe Domain Coordinates for d2g1da1:

Click to download the PDB-style file with coordinates for d2g1da1.
(The format of our PDB-style files is described here.)

Timeline for d2g1da1: