Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.12: Class B acid phosphatase, AphA [102307] (1 protein) the insertion subdomain is a helical hairpin automatically mapped to Pfam PF03767 |
Protein Class B acid phosphatase, AphA [102308] (2 species) |
Species Escherichia coli [TaxId:562] [102309] (11 PDB entries) Uniprot P32697 27-237 |
Domain d2g1ab_: 2g1a B: [134515] automated match to d1rm7a_ complexed with 5hg, mg |
PDB Entry: 2g1a (more details), 2 Å
SCOPe Domain Sequences for d2g1ab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g1ab_ c.108.1.12 (B:) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]} splnpgtnvarlaeqapihwvsvaqienslagrppmavgfdiddtvlfsspgfwrgkktf spesedylknpvfwekmnngwdefsipkevarqlidmhvrrgdaiffvtgrsptktetvs ktladnfhipatnmnpvifagdkpgqntksqwlqdknirifygdsdnditaardvgargi rilrasnstykplpqagafgeevivnsey
Timeline for d2g1ab_: