Lineage for d2g17a2 (2g17 A:154-308)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1915719Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 1915720Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 1915721Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 1916056Protein N-acetyl-gamma-glutamyl-phosphate reductase ArgC [111046] (3 species)
  7. 1916057Species Salmonella typhimurium [TaxId:90371] [143539] (1 PDB entry)
    Uniprot Q8ZKL8 154-308
  8. 1916058Domain d2g17a2: 2g17 A:154-308 [134513]
    Other proteins in same PDB: d2g17a1
    complexed with so4

Details for d2g17a2

PDB Entry: 2g17 (more details), 2.3 Å

PDB Description: The structure of N-acetyl-gamma-glutamyl-phosphate reductase from Salmonella typhimurium.
PDB Compounds: (A:) N-acetyl-gamma-glutamyl-phosphate reductase

SCOPe Domain Sequences for d2g17a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g17a2 d.81.1.1 (A:154-308) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]}
cyptaaqlslkplidgglldltqwpvinatsgvsgagrkaaisnsfcevslqpygvfthr
hqpeiavhlgaeviftphlgnfprgiletitcrlkagvthaqvadvlqkaygdkplvrly
dkgvpalknvvglpfcdigfavqgehlivvatedn

SCOPe Domain Coordinates for d2g17a2:

Click to download the PDB-style file with coordinates for d2g17a2.
(The format of our PDB-style files is described here.)

Timeline for d2g17a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2g17a1