![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.81: FwdE/GAPDH domain-like [55346] (3 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
![]() | Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) ![]() N-terminal domain is the classic Rossmann-fold |
![]() | Family d.81.1.1: GAPDH-like [55348] (6 proteins) has many additional secondary structures |
![]() | Protein N-acetyl-gamma-glutamyl-phosphate reductase ArgC [111046] (3 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [143539] (1 PDB entry) |
![]() | Domain d2g17a2: 2g17 A:154-308 [134513] Other proteins in same PDB: d2g17a1 complexed with so4 |
PDB Entry: 2g17 (more details), 2.3 Å
SCOP Domain Sequences for d2g17a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g17a2 d.81.1.1 (A:154-308) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 602]} cyptaaqlslkplidgglldltqwpvinatsgvsgagrkaaisnsfcevslqpygvfthr hqpeiavhlgaeviftphlgnfprgiletitcrlkagvthaqvadvlqkaygdkplvrly dkgvpalknvvglpfcdigfavqgehlivvatedn
Timeline for d2g17a2: