SCOP 1.73: Domain d2g17a2: 2g17 A:154-308

Lineage for d2g17a2 (2g17 A:154-308)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.81: FwdE/GAPDH domain-like [55346] (3 superfamilies)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.1: GAPDH-like [55348] (6 proteins)
   has many additional secondary structures

6. Protein N-acetyl-gamma-glutamyl-phosphate reductase ArgC [111046] (3 species)

7. Species Salmonella typhimurium [TaxId:90371] [143539] (1 PDB entry)

8. Domain d2g17a2: 2g17 A:154-308 [134513]
   Other proteins in same PDB: d2g17a1
   complexed with so4

Details for d2g17a2

PDB Entry: 2g17, 2.3 Å

PDB Description: The structure of N-acetyl-gamma-glutamyl-phosphate reductase from Salmonella typhimurium.

PDB Compounds: (A:) N-acetyl-gamma-glutamyl-phosphate reductase

SCOP Domain Sequences for d2g17a2:

Sequence; same for both SEQRES and ATOM records:

>d2g17a2 d.81.1.1 (A:154-308) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 602]}
cyptaaqlslkplidgglldltqwpvinatsgvsgagrkaaisnsfcevslqpygvfthr
hqpeiavhlgaeviftphlgnfprgiletitcrlkagvthaqvadvlqkaygdkplvrly
dkgvpalknvvglpfcdigfavqgehlivvatedn

Timeline for d2g17a2:

• d2g17a2 is new in SCOP 1.73
  
• d2g17a2 appears in SCOP 1.75
  
• d2g17a2 appears in the current release, SCOPe 2.08