![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
![]() | Protein N-acetyl-gamma-glutamyl-phosphate reductase ArgC [110423] (3 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [141918] (1 PDB entry) Uniprot Q8ZKL8 1-153,309-334 |
![]() | Domain d2g17a1: 2g17 A:1-153,A:309-334 [134512] Other proteins in same PDB: d2g17a2, d2g17a3 complexed with so4 |
PDB Entry: 2g17 (more details), 2.3 Å
SCOPe Domain Sequences for d2g17a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} mlntlivgasgyagaelvsyvnrhphmtitaltvsaqsndagklisdlhpqlkgivdlpl qpmsdvrdfsadvdvvflatahevshdlapqflqagcvvfdlsgafrvndrafyekyygf thqypelleqavyglaewnvdklntanliavpgXllkgaaaqavqcanirfgfaetqsli
Timeline for d2g17a1: