SCOPe 2.07: Domain d2g0za_: 2g0z A:

Lineage for d2g0za_ (2g0z A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (10 species)

7. Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (316 PDB entries)
   Uniprot P02185

8. Domain d2g0za_: 2g0z A: [134507]
   automated match to d1jdo__
   complexed with cmo, hem, so4

Details for d2g0za_

PDB Entry: 2g0z, 1.95 Å

PDB Description: photolyzed co l29f myoglobin: 1ns

PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d2g0za_:

Sequence; same for both SEQRES and ATOM records:

>d2g0za_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
mvlsegewqlvlhvwakveadvaghgqdifirlfkshpetlekfdrfkhlkteaemkase
dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg

Timeline for d2g0za_:

• d2g0za_ first appeared in SCOP 1.73, called d2g0za1
  
• d2g0za_ appears in SCOPe 2.06
  
• d2g0za_ appears in the current release, SCOPe 2.08