Class b: All beta proteins [48724] (180 folds) |
Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.80.8: Pentapeptide repeat-like [141571] (2 families) superhelix turns are made of four short strands each; duplication: the sequence pentapeptide repeats correspond to individual strands |
Family b.80.8.1: Pentapeptide repeats [141572] (4 proteins) Pfam PF00805 (covers eight repeats or two full superhelical turns) this is a repeat family; one repeat unit is 2bm4 A:81-101 found in domain |
Protein Lumenal RFR-domain protein [141577] (1 species) |
Species Cyanothece sp. atcc 51142 [TaxId:43989] [141578] (2 PDB entries) |
Domain d2g0ya_: 2g0y A: [134506] automated match to d2f3la1 complexed with ca applies to all domains of a family if the common domain is composed of a different number of small repeating units |
PDB Entry: 2g0y (more details), 2.3 Å
SCOPe Domain Sequences for d2g0ya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g0ya_ b.80.8.1 (A:) Lumenal RFR-domain protein {Cyanothece sp. atcc 51142 [TaxId: 43989]} sasyedvkligedfsgksltyaqftnadltdsnfseadlrgavfngsaligadlhgadlt nglayltsfkgadltnavlteaimmrtkfddakitgadfslavldvyevdklcdradgvn pktgvstreslrc
Timeline for d2g0ya_: