SCOPe 2.08: Domain d2g0ya_: 2g0y A:

Lineage for d2g0ya_ (2g0y A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.80.8: Pentapeptide repeat-like [141571] (2 families)
   superhelix turns are made of four short strands each; duplication: the sequence pentapeptide repeats correspond to individual strands

5. Family b.80.8.1: Pentapeptide repeats [141572] (4 proteins)
   Pfam PF00805 (covers eight repeats or two full superhelical turns)
   this is a repeat family; one repeat unit is 2bm4 A:81-101 found in domain

6. Protein Lumenal RFR-domain protein [141577] (1 species)

7. Species Cyanothece sp. atcc 51142 [TaxId:43989] [141578] (2 PDB entries)

8. Domain d2g0ya_: 2g0y A: [134506]
   automated match to d2f3la1
   complexed with ca
   applies to all domains of a family if the common domain is composed of a different number of small repeating units

Details for d2g0ya_

PDB Entry: 2g0y, 2.3 Å

PDB Description: Crystal Structure of a Lumenal Pentapeptide Repeat Protein from Cyanothece sp 51142 at 2.3 Angstrom Resolution. Tetragonal Crystal Form

PDB Compounds: (A:) pentapeptide repeat protein

SCOPe Domain Sequences for d2g0ya_:

Sequence; same for both SEQRES and ATOM records:

>d2g0ya_ b.80.8.1 (A:) Lumenal RFR-domain protein {Cyanothece sp. atcc 51142 [TaxId: 43989]}
sasyedvkligedfsgksltyaqftnadltdsnfseadlrgavfngsaligadlhgadlt
nglayltsfkgadltnavlteaimmrtkfddakitgadfslavldvyevdklcdradgvn
pktgvstreslrc

Timeline for d2g0ya_:

• d2g0ya_ first appeared in SCOP 1.73, called d2g0ya1
  
• d2g0ya_ appears in SCOPe 2.07