SCOPe 2.08: Domain d2g0wb2: 2g0w B:1-283

Lineage for d2g0wb2 (2g0w B:1-283)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.15: Xylose isomerase-like [51658] (8 families)
   different families share similar but non-identical metal-binding sites

5. Family c.1.15.4: IolI-like [75090] (3 proteins)

6. Protein Hypothetical protein Lmo2234 [141852] (1 species)

7. Species Listeria monocytogenes [TaxId:1639] [141853] (1 PDB entry)
   Uniprot Q8Y542 10-284

8. Domain d2g0wb2: 2g0w B:1-283 [134504]
   Other proteins in same PDB: d2g0wb3
   automated match to d2g0wa1
   complexed with mg, pg4

Details for d2g0wb2

PDB Entry: 2g0w, 1.7 Å

PDB Description: crystal structure of a putative sugar isomerase (lmo2234) from listeria monocytogenes at 1.70 a resolution

PDB Compounds: (B:) Lmo2234 protein

SCOPe Domain Sequences for d2g0wb2:

Sequence; same for both SEQRES and ATOM records:

>d2g0wb2 c.1.15.4 (B:1-283) Hypothetical protein Lmo2234 {Listeria monocytogenes [TaxId: 1639]}
mtnangnlkkcpitissytlgtevsfpkrvkvaaengfdgiglraenyvdalaagltded
mlrildehnmkvteveyitqwgtaedrtaeqqkkeqttfhmarlfgvkhincgllekipe
eqiivalgelcdraeeliiglefmpysgvadlqaawrvaeacgrdnaqlicdtwhwaran
qtaesiknvpadrivsiqlcdvhetpykelreeslhdrlapgegygdtvgfakilkehgv
nprvmgvevisdsmvatgleyaalkvynatkkvldeawpeisp

Timeline for d2g0wb2:

• d2g0wb2 first appeared in SCOP 1.73, called d2g0wb1
  
• d2g0wb2 appears in SCOPe 2.07