![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) ![]() different families share similar but non-identical metal-binding sites |
![]() | Family c.1.15.4: IolI-like [75090] (3 proteins) |
![]() | Protein Hypothetical protein Lmo2234 [141852] (1 species) |
![]() | Species Listeria monocytogenes [TaxId:1639] [141853] (1 PDB entry) Uniprot Q8Y542 10-284 |
![]() | Domain d2g0wa1: 2g0w A:10-284 [134503] Other proteins in same PDB: d2g0wb3 complexed with mg, pg4 |
PDB Entry: 2g0w (more details), 1.7 Å
SCOPe Domain Sequences for d2g0wa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g0wa1 c.1.15.4 (A:10-284) Hypothetical protein Lmo2234 {Listeria monocytogenes [TaxId: 1639]} kcpitissytlgtevsfpkrvkvaaengfdgiglraenyvdalaagltdedmlrildehn mkvteveyitqwgtaedrtaeqqkkeqttfhmarlfgvkhincgllekipeeqiivalge lcdraeeliiglefmpysgvadlqaawrvaeacgrdnaqlicdtwhwaranqtaesiknv padrivsiqlcdvhetpykelreeslhdrlapgegygdtvgfakilkehgvnprvmgvev isdsmvatgleyaalkvynatkkvldeawpeispr
Timeline for d2g0wa1: