Lineage for d2g0wa1 (2g0w A:10-284)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2839044Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) (S)
    different families share similar but non-identical metal-binding sites
  5. 2839386Family c.1.15.4: IolI-like [75090] (3 proteins)
  6. 2839391Protein Hypothetical protein Lmo2234 [141852] (1 species)
  7. 2839392Species Listeria monocytogenes [TaxId:1639] [141853] (1 PDB entry)
    Uniprot Q8Y542 10-284
  8. 2839393Domain d2g0wa1: 2g0w A:10-284 [134503]
    Other proteins in same PDB: d2g0wb3
    complexed with mg, pg4

Details for d2g0wa1

PDB Entry: 2g0w (more details), 1.7 Å

PDB Description: crystal structure of a putative sugar isomerase (lmo2234) from listeria monocytogenes at 1.70 a resolution
PDB Compounds: (A:) Lmo2234 protein

SCOPe Domain Sequences for d2g0wa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g0wa1 c.1.15.4 (A:10-284) Hypothetical protein Lmo2234 {Listeria monocytogenes [TaxId: 1639]}
kcpitissytlgtevsfpkrvkvaaengfdgiglraenyvdalaagltdedmlrildehn
mkvteveyitqwgtaedrtaeqqkkeqttfhmarlfgvkhincgllekipeeqiivalge
lcdraeeliiglefmpysgvadlqaawrvaeacgrdnaqlicdtwhwaranqtaesiknv
padrivsiqlcdvhetpykelreeslhdrlapgegygdtvgfakilkehgvnprvmgvev
isdsmvatgleyaalkvynatkkvldeawpeispr

SCOPe Domain Coordinates for d2g0wa1:

Click to download the PDB-style file with coordinates for d2g0wa1.
(The format of our PDB-style files is described here.)

Timeline for d2g0wa1: