Lineage for d2g0ua1 (2g0u A:1-84)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 633305Fold a.2: Long alpha-hairpin [46556] (19 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 633814Superfamily a.2.20: MxiH-like [140129] (1 family) (S)
    Type III secretion system needle
  5. 633815Family a.2.20.1: MxiH-like [140130] (2 proteins)
  6. 633816Protein BsaL needle protein [140133] (1 species)
  7. 633817Species Burkholderia pseudomallei [TaxId:28450] [140134] (1 PDB entry)
  8. 633818Domain d2g0ua1: 2g0u A:1-84 [134501]

Details for d2g0ua1

PDB Entry: 2g0u (more details)

PDB Description: solution structure of monomeric bsal, the type iii secretion needle protein of burkholderia pseudomallei
PDB Compounds: (A:) type III secretion system needle protein

SCOP Domain Sequences for d2g0ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g0ua1 a.2.20.1 (A:1-84) BsaL needle protein {Burkholderia pseudomallei [TaxId: 28450]}
msnpptplladyewsgyltgigrafddgvkdlnkqlqdaqanltknpsdptalanyqmim
seynlyrnaqssavksmkdidssi

SCOP Domain Coordinates for d2g0ua1:

Click to download the PDB-style file with coordinates for d2g0ua1.
(The format of our PDB-style files is described here.)

Timeline for d2g0ua1: