SCOPe 2.08: Domain d2g0ua1: 2g0u A:1-84

Lineage for d2g0ua1 (2g0u A:1-84)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.20: MxiH-like [140129] (2 families)
   Type III secretion system needle

5. Family a.2.20.1: MxiH-like [140130] (3 proteins)

6. Protein BsaL needle protein [140133] (1 species)

7. Species Burkholderia pseudomallei [TaxId:28450] [140134] (1 PDB entry)
   Uniprot Q63K18 1-84

8. Domain d2g0ua1: 2g0u A:1-84 [134501]
   Other proteins in same PDB: d2g0ua2

Details for d2g0ua1

PDB Entry: 2g0u

PDB Description: solution structure of monomeric bsal, the type iii secretion needle protein of burkholderia pseudomallei

PDB Compounds: (A:) type III secretion system needle protein

SCOPe Domain Sequences for d2g0ua1:

Sequence; same for both SEQRES and ATOM records:

>d2g0ua1 a.2.20.1 (A:1-84) BsaL needle protein {Burkholderia pseudomallei [TaxId: 28450]}
msnpptplladyewsgyltgigrafddgvkdlnkqlqdaqanltknpsdptalanyqmim
seynlyrnaqssavksmkdidssi

Timeline for d2g0ua1:

• d2g0ua1 first appeared in SCOP 1.73
  
• d2g0ua1 appears in SCOPe 2.07