SCOP 1.73: Domain d2g0tb1: 2g0t B:1-338

Lineage for d2g0tb1 (2g0t B:1-338)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.10: Nitrogenase iron protein-like [52652] (13 proteins)
   core: parallel beta-sheet of 7 strands; order 3241567

6. Protein Hypothetical protein TM0796 [142299] (1 species)
   member of Pfam PF07755; DUF1611; contains extra N-terminal alpha/beta fold of Rossmann-fold topology, parallel beta-sheet, strand order 312456

7. Species Thermotoga maritima [TaxId:2336] [142300] (1 PDB entry)

8. Domain d2g0tb1: 2g0t B:1-338 [134500]
   automatically matched to 2G0T A:1-338
   complexed with edo, fmt, po4

Details for d2g0tb1

PDB Entry: 2g0t, 2.67 Å

PDB Description: Crystal structure of a putative nucleotide binding protein (tm0796) from Thermotoga maritima at 2.67 A resolution

PDB Compounds: (B:) conserved hypothetical protein

SCOP Domain Sequences for d2g0tb1:

Sequence; same for both SEQRES and ATOM records:

>d2g0tb1 c.37.1.10 (B:1-338) Hypothetical protein TM0796 {Thermotoga maritima [TaxId: 2336]}
mdlwklyqpgtpaaivawgqlgtahakttygllrhsrlfkpvcvvaehegkmasdfvkpv
rydvpvvssvekakemgaevliigvsnpggyleeqiatlvkkalslgmdvisglhfkisq
qteflkiahengtriidirippleldvlrggiyrkkikvvgvfgtdcvvgkrttavqlwe
ralekgikagflatgqtgiligadagyvidavpadfvsgvvekavlklektgkeivfveg
qgalrhpaygqvtlgllygsnpdvvflvhdpsrdhfesfpeipkkpdfeeerrlietlsn
akviggvslnggfetdlpvydpfntddldemleramvw

Timeline for d2g0tb1:

• d2g0tb1 is new in SCOP 1.73
  
• d2g0tb1 appears in SCOP 1.75
  
• d2g0tb1 appears in the current release, SCOPe 2.08, called d2g0tb2