![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins) core: parallel beta-sheet of 7 strands; order 3241567 |
![]() | Protein Hypothetical protein TM0796 [142299] (1 species) member of Pfam PF07755; DUF1611; contains extra N-terminal alpha/beta fold of Rossmann-fold topology, parallel beta-sheet, strand order 312456 |
![]() | Species Thermotoga maritima [TaxId:2336] [142300] (1 PDB entry) Uniprot Q9WZQ3 1-338 |
![]() | Domain d2g0tb2: 2g0t B:1-338 [134500] Other proteins in same PDB: d2g0ta2, d2g0tb3 automated match to d2g0ta1 complexed with edo, fmt, po4 has additional subdomain(s) that are not in the common domain |
PDB Entry: 2g0t (more details), 2.67 Å
SCOPe Domain Sequences for d2g0tb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g0tb2 c.37.1.10 (B:1-338) Hypothetical protein TM0796 {Thermotoga maritima [TaxId: 2336]} mdlwklyqpgtpaaivawgqlgtahakttygllrhsrlfkpvcvvaehegkmasdfvkpv rydvpvvssvekakemgaevliigvsnpggyleeqiatlvkkalslgmdvisglhfkisq qteflkiahengtriidirippleldvlrggiyrkkikvvgvfgtdcvvgkrttavqlwe ralekgikagflatgqtgiligadagyvidavpadfvsgvvekavlklektgkeivfveg qgalrhpaygqvtlgllygsnpdvvflvhdpsrdhfesfpeipkkpdfeeerrlietlsn akviggvslnggfetdlpvydpfntddldemleramvw
Timeline for d2g0tb2: