Lineage for d2g0tb2 (2g0t B:1-338)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2869013Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 2869192Protein Hypothetical protein TM0796 [142299] (1 species)
    member of Pfam PF07755; DUF1611; contains extra N-terminal alpha/beta fold of Rossmann-fold topology, parallel beta-sheet, strand order 312456
  7. 2869193Species Thermotoga maritima [TaxId:2336] [142300] (1 PDB entry)
    Uniprot Q9WZQ3 1-338
  8. 2869195Domain d2g0tb2: 2g0t B:1-338 [134500]
    Other proteins in same PDB: d2g0ta2, d2g0tb3
    automated match to d2g0ta1
    complexed with edo, fmt, po4

    has additional subdomain(s) that are not in the common domain

Details for d2g0tb2

PDB Entry: 2g0t (more details), 2.67 Å

PDB Description: Crystal structure of a putative nucleotide binding protein (tm0796) from Thermotoga maritima at 2.67 A resolution
PDB Compounds: (B:) conserved hypothetical protein

SCOPe Domain Sequences for d2g0tb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g0tb2 c.37.1.10 (B:1-338) Hypothetical protein TM0796 {Thermotoga maritima [TaxId: 2336]}
mdlwklyqpgtpaaivawgqlgtahakttygllrhsrlfkpvcvvaehegkmasdfvkpv
rydvpvvssvekakemgaevliigvsnpggyleeqiatlvkkalslgmdvisglhfkisq
qteflkiahengtriidirippleldvlrggiyrkkikvvgvfgtdcvvgkrttavqlwe
ralekgikagflatgqtgiligadagyvidavpadfvsgvvekavlklektgkeivfveg
qgalrhpaygqvtlgllygsnpdvvflvhdpsrdhfesfpeipkkpdfeeerrlietlsn
akviggvslnggfetdlpvydpfntddldemleramvw

SCOPe Domain Coordinates for d2g0tb2:

Click to download the PDB-style file with coordinates for d2g0tb2.
(The format of our PDB-style files is described here.)

Timeline for d2g0tb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2g0tb3