SCOPe 2.08: Domain d2g0la_: 2g0l A:

Lineage for d2g0la_ (2g0l A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.7: Actinoxanthin-like [49319] (1 family)
   automatically mapped to Pfam PF00960

5. Family b.1.7.1: Actinoxanthin-like [49320] (6 proteins)

6. Protein Neocarzinostatin [49323] (1 species)

7. Species Streptomyces carzinostaticus [TaxId:1897] [49324] (7 PDB entries)

8. Domain d2g0la_: 2g0l A: [134496]
   automated match to d1noaa_
   complexed with fln

Details for d2g0la_

PDB Entry: 2g0l

PDB Description: solution structure of neocarzinostatin apo-protein with bound flavone

PDB Compounds: (A:) neocarzinostatin

SCOPe Domain Sequences for d2g0la_:

Sequence; same for both SEQRES and ATOM records:

>d2g0la_ b.1.7.1 (A:) Neocarzinostatin {Streptomyces carzinostaticus [TaxId: 1897]}
aaptatvtpssglsdgtvvkvagaglqagtaydvgqcawvdtgvlacnpadfssvtadan
gsastsltvrrsfegflfdgtrwgtvdcttaacqvglsdaagngpegvaisfn

Timeline for d2g0la_:

• d2g0la_ first appeared in SCOP 1.73, called d2g0la1
  
• d2g0la_ appears in SCOPe 2.07