Lineage for d2g0ka_ (2g0k A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2763669Superfamily b.1.7: Actinoxanthin-like [49319] (1 family) (S)
    automatically mapped to Pfam PF00960
  5. 2763670Family b.1.7.1: Actinoxanthin-like [49320] (6 proteins)
  6. 2763686Protein Neocarzinostatin [49323] (1 species)
  7. 2763687Species Streptomyces carzinostaticus [TaxId:1897] [49324] (7 PDB entries)
  8. 2763692Domain d2g0ka_: 2g0k A: [134495]
    automated match to d1noaa_

Details for d2g0ka_

PDB Entry: 2g0k (more details)

PDB Description: solution structure of neocarzinostatin apo-protein
PDB Compounds: (A:) neocarzinostatin

SCOPe Domain Sequences for d2g0ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g0ka_ b.1.7.1 (A:) Neocarzinostatin {Streptomyces carzinostaticus [TaxId: 1897]}
aaptatvtpssglsdgtvvkvagaglqagtaydvgqcawvdtgvlacnpadfssvtadan
gsastsltvrrsfegflfdgtrwgtvdcttaacqvglsdaagngpegvaisfn

SCOPe Domain Coordinates for d2g0ka_:

Click to download the PDB-style file with coordinates for d2g0ka_.
(The format of our PDB-style files is described here.)

Timeline for d2g0ka_: