SCOPe 2.01: Domain d2g0ha_: 2g0h A:

Lineage for d2g0ha_ (2g0h A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)

6. Protein Peroxisome proliferator activated receptor gamma, PPAR-gamma [48524] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48525] (59 PDB entries)
   Uniprot P37231 232-505

8. Domain d2g0ha_: 2g0h A: [134493]
   automated match to d1fm6d_
   complexed with sp3

Details for d2g0ha_

PDB Entry: 2g0h, 2.3 Å

PDB Description: Structure-based drug design of a novel family of PPAR partial agonists: virtual screening, x-ray crystallography and in vitro/in vivo biological activities

PDB Compounds: (A:) Peroxisome proliferator-activated receptor gamma

SCOPe Domain Sequences for d2g0ha_:

Sequence; same for both SEQRES and ATOM records:

>d2g0ha_ a.123.1.1 (A:) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
tehvqllqvikktetdmslhpllqeiykdly

Timeline for d2g0ha_:

• d2g0ha_ first appeared in SCOP 1.73, called d2g0ha1
  
• d2g0ha_ was called d2g0ha1 in SCOP 1.75
  
• d2g0ha_ appears in SCOPe 2.02
  
• d2g0ha_ appears in the current release, SCOPe 2.08