![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.265: Fic-like [140930] (1 superfamily) multihelical; one central helix is surrounded by seven helices |
![]() | Superfamily a.265.1: Fic-like [140931] (1 family) ![]() |
![]() | Family a.265.1.1: Fic-like [140932] (3 proteins) Pfam PF02661; the conserved motif HPFXXGNG is at the N-terminus of the central helix |
![]() | Protein Hypothetical protein NMA0004 [140935] (1 species) |
![]() | Species Neisseria meningitidis [TaxId:487] [140936] (1 PDB entry) Uniprot Q9JQR9 11-187 |
![]() | Domain d2g03a1: 2g03 A:11-187 [134490] complexed with acy, ipa |
PDB Entry: 2g03 (more details), 2.2 Å
SCOPe Domain Sequences for d2g03a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g03a1 a.265.1.1 (A:11-187) Hypothetical protein NMA0004 {Neisseria meningitidis [TaxId: 487]} mksideqslhnarrlfesgdidrievgttaglqqihrylfgglydfagqiredniskggf rfanamylkealvkieqmpertfeeiiakyvemniahpflegngrstriwldlvlkknlk kvvnwqnvsktlylqamerspvndlelrfllkdnltddvdnreiifkgieqsyyyeg
Timeline for d2g03a1: