Lineage for d2fzwb1 (2fzw B:1-162,B:339-373)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1538001Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 1538002Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. 1538123Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 1538141Protein Alcohol dehydrogenase [50137] (9 species)
    contains a Zn-finger subdomain, residues 94-117
  7. 1538244Species Human (Homo sapiens), different isozymes [TaxId:9606] [50139] (24 PDB entries)
    Uniprot P00326 ! Uniprot P00325 ! Uniprot P07327
  8. 1538252Domain d2fzwb1: 2fzw B:1-162,B:339-373 [134484]
    Other proteins in same PDB: d2fzwa2, d2fzwb2
    automatically matched to d1m6ha1
    complexed with k, nad, po4, zn; mutant

Details for d2fzwb1

PDB Entry: 2fzw (more details), 1.84 Å

PDB Description: structure of the binary complex of the e67l mutant of human glutathione-dependent formaldehyde dehydrogenase with nad(h)
PDB Compounds: (B:) Alcohol dehydrogenase class III chi chain

SCOPe Domain Sequences for d2fzwb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fzwb1 b.35.1.2 (B:1-162,B:339-373) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]}
anevikckaavaweagkplsieeievappkahevrikiiatavchtdaytlsgadpegcf
pvilghlgagivesvgegvtklkagdtviplyipqcgeckfclnpktnlcqkirvtqgkg
lmpdgtsrftckgktilhymgtstfseytvvadisvakidplXikvdefvthnlsfdein
kafelmhsgksirtvvki

SCOPe Domain Coordinates for d2fzwb1:

Click to download the PDB-style file with coordinates for d2fzwb1.
(The format of our PDB-style files is described here.)

Timeline for d2fzwb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fzwb2