SCOPe 2.08: Domain d2fzwb1: 2fzw B:1-162,B:339-373

Lineage for d2fzwb1 (2fzw B:1-162,B:339-373)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)
   contains barrel, partly opened; n*=4, S*=8; meander

4. Superfamily b.35.1: GroES-like [50129] (3 families)

5. Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
   C-terminal domain is alpha/beta (classical Rossmann-fold)

6. Protein Alcohol dehydrogenase [50137] (9 species)
   contains a Zn-finger subdomain, residues 94-117

7. Species Human (Homo sapiens), different isozymes [TaxId:9606] [50139] (24 PDB entries)
   Uniprot P00326 ! Uniprot P00325 ! Uniprot P07327

8. Domain d2fzwb1: 2fzw B:1-162,B:339-373 [134484]
   Other proteins in same PDB: d2fzwa2, d2fzwb2
   automatically matched to d1m6ha1
   complexed with k, nad, po4, zn; mutant

Details for d2fzwb1

PDB Entry: 2fzw, 1.84 Å

PDB Description: structure of the binary complex of the e67l mutant of human glutathione-dependent formaldehyde dehydrogenase with nad(h)

PDB Compounds: (B:) Alcohol dehydrogenase class III chi chain

SCOPe Domain Sequences for d2fzwb1:

Sequence; same for both SEQRES and ATOM records:

>d2fzwb1 b.35.1.2 (B:1-162,B:339-373) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]}
anevikckaavaweagkplsieeievappkahevrikiiatavchtdaytlsgadpegcf
pvilghlgagivesvgegvtklkagdtviplyipqcgeckfclnpktnlcqkirvtqgkg
lmpdgtsrftckgktilhymgtstfseytvvadisvakidplXikvdefvthnlsfdein
kafelmhsgksirtvvki

Timeline for d2fzwb1:

• d2fzwb1 first appeared in SCOP 1.73
  
• d2fzwb1 appears in SCOPe 2.07