SCOPe 2.03: Domain d2fzva1: 2fzv A:1-233

Lineage for d2fzva1 (2fzv A:1-233)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.4: NADPH-dependent FMN reductase [89590] (5 proteins)
   Pfam PF03358

6. Protein Putative arsenical resistance protein [142051] (1 species)

7. Species Shigella flexneri [TaxId:623] [142052] (1 PDB entry)
   Uniprot Q7UC03 1-233

8. Domain d2fzva1: 2fzv A:1-233 [134478]
   complexed with ca, cl

Details for d2fzva1

PDB Entry: 2fzv, 1.7 Å

PDB Description: crystal structure of an apo form of a flavin-binding protein from shigella flexneri

PDB Compounds: (A:) putative arsenical resistance protein

SCOPe Domain Sequences for d2fzva1:

Sequence; same for both SEQRES and ATOM records:

>d2fzva1 c.23.5.4 (A:1-233) Putative arsenical resistance protein {Shigella flexneri [TaxId: 623]}
mrlrhlsdpdslpaldksfaierpalglapdappvrilllygslrarsfsrlaveeaarl
lqffgaetrifdpsdlplpdqvqsddhpavkelralsewsegqvwcsperhgqitsvmka
qidhlplemagirptqgrtlavmqvsggsqsfnavntlrllgrwmrmftipnqssiakaf
qefdaagrmkpspyydriadvmeelvrftalvrphrealtdryserkaaghvi

Timeline for d2fzva1:

• d2fzva1 first appeared in SCOP 1.73
  
• d2fzva1 appears in SCOPe 2.02
  
• d2fzva1 appears in SCOPe 2.04
  
• d2fzva1 appears in the current release, SCOPe 2.08