Lineage for d2fzsl1 (2fzs L:16-193)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 824388Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 824389Superfamily c.14.1: ClpP/crotonase [52096] (4 families) (S)
  5. 824390Family c.14.1.1: Clp protease, ClpP subunit [52097] (1 protein)
  6. 824391Protein Clp protease, ClpP subunit [52098] (5 species)
  7. 824392Species Escherichia coli [TaxId:562] [52099] (4 PDB entries)
  8. 824418Domain d2fzsl1: 2fzs L:16-193 [134473]
    automatically matched to d1tyfa_
    complexed with cmq, gol, pge

Details for d2fzsl1

PDB Entry: 2fzs (more details), 1.9 Å

PDB Description: Crystal structure of E. coli ClpP with a Peptide Chloromethyl Ketone Covalently Bound at the Active Site
PDB Compounds: (L:) ATP-dependent Clp protease proteolytic subunit

SCOP Domain Sequences for d2fzsl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fzsl1 c.14.1.1 (L:16-193) Clp protease, ClpP subunit {Escherichia coli [TaxId: 562]}
sfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspggvitagms
iydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplggyqgqatdi
eihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvdsilthrn

SCOP Domain Coordinates for d2fzsl1:

Click to download the PDB-style file with coordinates for d2fzsl1.
(The format of our PDB-style files is described here.)

Timeline for d2fzsl1: