Lineage for d2fzsc_ (2fzs C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2852295Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins)
    automatically mapped to Pfam PF00574
  6. 2852608Protein automated matches [190149] (14 species)
    not a true protein
  7. 2852709Species Escherichia coli [TaxId:562] [186874] (4 PDB entries)
  8. 2852726Domain d2fzsc_: 2fzs C: [134464]
    automated match to d1tyfa_
    complexed with cmq, gol, pge

Details for d2fzsc_

PDB Entry: 2fzs (more details), 1.9 Å

PDB Description: Crystal structure of E. coli ClpP with a Peptide Chloromethyl Ketone Covalently Bound at the Active Site
PDB Compounds: (C:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d2fzsc_:

Sequence, based on SEQRES records: (download)

>d2fzsc_ c.14.1.1 (C:) automated matches {Escherichia coli [TaxId: 562]}
vpmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiyly
inspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmih
qplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeavey
glvdsilthrn

Sequence, based on observed residues (ATOM records): (download)

>d2fzsc_ c.14.1.1 (C:) automated matches {Escherichia coli [TaxId: 562]}
vpmvrsfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspggvi
tagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplggyqg
qatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvdsilt
hrn

SCOPe Domain Coordinates for d2fzsc_:

Click to download the PDB-style file with coordinates for d2fzsc_.
(The format of our PDB-style files is described here.)

Timeline for d2fzsc_: