Lineage for d2fzsb_ (2fzs B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 980706Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 980707Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 980708Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins)
  6. 980845Protein automated matches [190149] (5 species)
    not a true protein
  7. 980897Species Escherichia coli [TaxId:562] [186874] (3 PDB entries)
  8. 980913Domain d2fzsb_: 2fzs B: [134463]
    automated match to d1tyfa_
    complexed with cmq, gol, pge

Details for d2fzsb_

PDB Entry: 2fzs (more details), 1.9 Å

PDB Description: Crystal structure of E. coli ClpP with a Peptide Chloromethyl Ketone Covalently Bound at the Active Site
PDB Compounds: (B:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d2fzsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fzsb_ c.14.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
lvpmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiyl
yinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmi
hqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeave
yglvdsilthrn

SCOPe Domain Coordinates for d2fzsb_:

Click to download the PDB-style file with coordinates for d2fzsb_.
(The format of our PDB-style files is described here.)

Timeline for d2fzsb_: