Lineage for d2fzna1 (2fzn A:88-261)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1752692Fold a.176: N-terminal domain of bifunctional PutA protein [81934] (1 superfamily)
    multihelical; array
  4. 1752693Superfamily a.176.1: N-terminal domain of bifunctional PutA protein [81935] (2 families) (S)
  5. 1752694Family a.176.1.1: N-terminal domain of bifunctional PutA protein [81936] (1 protein)
  6. 1752695Protein N-terminal domain of bifunctional PutA protein [81937] (2 species)
    includes the N-terminal swapping arm made of three helices; possible DNA-binding function
  7. 1752699Species Escherichia coli [TaxId:562] [81938] (7 PDB entries)
    Uniprot P09546 87-610
  8. 1752702Domain d2fzna1: 2fzn A:88-261 [134460]
    Other proteins in same PDB: d2fzna2
    automated match to d1tj1a1
    complexed with fad, pro

Details for d2fzna1

PDB Entry: 2fzn (more details), 2 Å

PDB Description: structure of the e. coli puta proline dehydrogenase domain reduced by dithionite and complexed with proline
PDB Compounds: (A:) Bifunctional protein putA, Proline dehydrogenase (EC 1.5.99.8) (Proline oxidase)

SCOPe Domain Sequences for d2fzna1:

Sequence, based on SEQRES records: (download)

>d2fzna1 a.176.1.1 (A:88-261) N-terminal domain of bifunctional PutA protein {Escherichia coli [TaxId: 562]}
qsvsraaitaayrrpeteavsmlleqarlpqpvaeqahklayqladklrnqknasgragm
vqgllqefslssqegvalmclaeallripdkatrdalirdkisngnwqshigrspslfvn
aatwgllftgklvsthneaslsrslnriigksgeplirkgvdmamrlmgeqfvt

Sequence, based on observed residues (ATOM records): (download)

>d2fzna1 a.176.1.1 (A:88-261) N-terminal domain of bifunctional PutA protein {Escherichia coli [TaxId: 562]}
qsvsraaitaayrrpeteavsmlleqarlpqpvaeqahklayqladklrnqknasgragg
valmclaeallripdkatrdalirkgvdmamrlmgeqfvt

SCOPe Domain Coordinates for d2fzna1:

Click to download the PDB-style file with coordinates for d2fzna1.
(The format of our PDB-style files is described here.)

Timeline for d2fzna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fzna2