Lineage for d2fzma1 (2fzm A:88-261)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014214Fold a.176: N-terminal domain of bifunctional PutA protein [81934] (1 superfamily)
    multihelical; array
  4. 2014215Superfamily a.176.1: N-terminal domain of bifunctional PutA protein [81935] (2 families) (S)
  5. 2014216Family a.176.1.1: N-terminal domain of bifunctional PutA protein [81936] (1 protein)
  6. 2014217Protein N-terminal domain of bifunctional PutA protein [81937] (2 species)
    includes the N-terminal swapping arm made of three helices; possible DNA-binding function
  7. 2014221Species Escherichia coli [TaxId:562] [81938] (7 PDB entries)
    Uniprot P09546 87-610
  8. 2014226Domain d2fzma1: 2fzm A:88-261 [134458]
    Other proteins in same PDB: d2fzma2
    automated match to d1tj1a1
    complexed with fad, so2

Details for d2fzma1

PDB Entry: 2fzm (more details), 2.3 Å

PDB Description: structure of the e. coli puta proline dehydrogenase domain reduced by dithionite and complexed with so2
PDB Compounds: (A:) Bifunctional protein putA, Proline dehydrogenase (EC 1.5.99.8) (Proline oxidase)

SCOPe Domain Sequences for d2fzma1:

Sequence, based on SEQRES records: (download)

>d2fzma1 a.176.1.1 (A:88-261) N-terminal domain of bifunctional PutA protein {Escherichia coli [TaxId: 562]}
qsvsraaitaayrrpeteavsmlleqarlpqpvaeqahklayqladklrnqknasgragm
vqgllqefslssqegvalmclaeallripdkatrdalirdkisngnwqshigrspslfvn
aatwgllftgklvsthneaslsrslnriigksgeplirkgvdmamrlmgeqfvt

Sequence, based on observed residues (ATOM records): (download)

>d2fzma1 a.176.1.1 (A:88-261) N-terminal domain of bifunctional PutA protein {Escherichia coli [TaxId: 562]}
qsvsraaitaayrrpeteavsmlleqarlpqpvaeqahklayqladklrnqknasgragm
gvalmclaeallripdkatrdalirkgvdmamrlmgeqfvt

SCOPe Domain Coordinates for d2fzma1:

Click to download the PDB-style file with coordinates for d2fzma1.
(The format of our PDB-style files is described here.)

Timeline for d2fzma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fzma2