SCOPe 2.08: Domain d2fzma1: 2fzm A:88-261

Lineage for d2fzma1 (2fzm A:88-261)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.176: N-terminal domain of bifunctional PutA protein [81934] (1 superfamily)
   multihelical; array

4. Superfamily a.176.1: N-terminal domain of bifunctional PutA protein [81935] (2 families)

5. Family a.176.1.1: N-terminal domain of bifunctional PutA protein [81936] (1 protein)

6. Protein N-terminal domain of bifunctional PutA protein [81937] (2 species)
   includes the N-terminal swapping arm made of three helices; possible DNA-binding function

7. Species Escherichia coli [TaxId:562] [81938] (7 PDB entries)
   Uniprot P09546 87-610

8. Domain d2fzma1: 2fzm A:88-261 [134458]
   Other proteins in same PDB: d2fzma2
   automated match to d1tj1a1
   complexed with fad, so2

Details for d2fzma1

PDB Entry: 2fzm, 2.3 Å

PDB Description: structure of the e. coli puta proline dehydrogenase domain reduced by dithionite and complexed with so2

PDB Compounds: (A:) Bifunctional protein putA, Proline dehydrogenase (EC 1.5.99.8) (Proline oxidase)

SCOPe Domain Sequences for d2fzma1:

Sequence, based on SEQRES records:

>d2fzma1 a.176.1.1 (A:88-261) N-terminal domain of bifunctional PutA protein {Escherichia coli [TaxId: 562]}
qsvsraaitaayrrpeteavsmlleqarlpqpvaeqahklayqladklrnqknasgragm
vqgllqefslssqegvalmclaeallripdkatrdalirdkisngnwqshigrspslfvn
aatwgllftgklvsthneaslsrslnriigksgeplirkgvdmamrlmgeqfvt

Sequence, based on observed residues (ATOM records):

>d2fzma1 a.176.1.1 (A:88-261) N-terminal domain of bifunctional PutA protein {Escherichia coli [TaxId: 562]}
qsvsraaitaayrrpeteavsmlleqarlpqpvaeqahklayqladklrnqknasgragm
gvalmclaeallripdkatrdalirkgvdmamrlmgeqfvt

Timeline for d2fzma1:

• d2fzma1 first appeared in SCOP 1.73
  
• d2fzma1 appears in SCOPe 2.07