Lineage for d2fzla1 (2fzl A:258-454)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870646Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 2870699Protein DNA repair protein RAD25 [142318] (1 species)
    shares with the DNA helicase UvsW (102396) extra N-terminal alpha+beta subdomain that might be related to the DNA repair protein MutS domain I (55271)
  7. 2870700Species Archaeoglobus fulgidus [TaxId:2234] [142319] (3 PDB entries)
    Uniprot O29889 237-436! Uniprot O29889 238-434! Uniprot O29889 3-236! Uniprot O29889 4-209
  8. 2870710Domain d2fzla1: 2fzl A:258-454 [134457]
    C-terminal domain only
    complexed with ipa

    has additional subdomain(s) that are not in the common domain

Details for d2fzla1

PDB Entry: 2fzl (more details), 2.9 Å

PDB Description: structure of c-terminal domain of archaeoglobus fulgidus xpb
PDB Compounds: (A:) DNA repair protein RAD25, XPB

SCOPe Domain Sequences for d2fzla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fzla1 c.37.1.19 (A:258-454) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]}
hlakytikrifvplaederveyekrekvykqflrargitlrraedfnkivmasgyderay
ealraweearriafnsknkirklreilerhrkdkiiiftrhnelvyriskvflipaithr
tsreereeilegfrtgrfraivssqvldegidvpdanvgvimsgsgsareyiqrlgrilr
pskgkkeavlyelisrg

SCOPe Domain Coordinates for d2fzla1:

Click to download the PDB-style file with coordinates for d2fzla1.
(The format of our PDB-style files is described here.)

Timeline for d2fzla1: