SCOPe 2.03: Domain d2fzkd2: 2fzk D:101-153

Lineage for d2fzkd2 (2fzk D:101-153)

1. Root: SCOPe 2.03

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (2 families)
   automatically mapped to Pfam PF02748

5. Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)

6. Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (3 species)

7. Species Escherichia coli [TaxId:562] [57828] (59 PDB entries)
   Uniprot P00478

8. Domain d2fzkd2: 2fzk D:101-153 [134456]
   Other proteins in same PDB: d2fzka1, d2fzka2, d2fzkb1, d2fzkc1, d2fzkc2, d2fzkd1
   automated match to d1d09b2
   complexed with ctp, eoz, zn

Details for d2fzkd2

PDB Entry: 2fzk, 2.5 Å

PDB Description: The Structure of Wild-Type E. Coli Aspartate Transcarbamoylase in Complex with Novel T State Inhibitors at 2.50 Resolution

PDB Compounds: (D:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d2fzkd2:

Sequence; same for both SEQRES and ATOM records:

>d2fzkd2 g.41.7.1 (D:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

Timeline for d2fzkd2:

• d2fzkd2 first appeared in SCOP 1.73
  
• d2fzkd2 appears in SCOPe 2.02
  
• d2fzkd2 appears in SCOPe 2.04
  
• d2fzkd2 appears in the current release, SCOPe 2.08