SCOPe 2.08: Domain d2fzkc1: 2fzk C:1-150

Lineage for d2fzkc1 (2fzk C:1-150)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)

5. Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)

6. Protein Aspartate carbamoyltransferase catalytic subunit [53673] (7 species)

7. Species Escherichia coli [TaxId:562] [53674] (62 PDB entries)
   Uniprot P00479

8. Domain d2fzkc1: 2fzk C:1-150 [134453]
   Other proteins in same PDB: d2fzkb1, d2fzkb2, d2fzkd1, d2fzkd2
   automated match to d3csua1
   complexed with ctp, eoz, zn

Details for d2fzkc1

PDB Entry: 2fzk, 2.5 Å

PDB Description: The Structure of Wild-Type E. Coli Aspartate Transcarbamoylase in Complex with Novel T State Inhibitors at 2.50 Resolution

PDB Compounds: (C:) Aspartate carbamoyltransferase catalytic chain

SCOPe Domain Sequences for d2fzkc1:

Sequence; same for both SEQRES and ATOM records:

>d2fzkc1 c.78.1.1 (C:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]}
anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
nvpvlnagdgsnqhptqtlldlftiqetqg

Timeline for d2fzkc1:

• d2fzkc1 first appeared in SCOP 1.73
  
• d2fzkc1 appears in SCOPe 2.07