SCOP 1.75: Domain d2fzkb2: 2fzk B:101-153

Lineage for d2fzkb2 (2fzk B:101-153)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (1 family)

5. Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)

6. Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (2 species)

7. Species Escherichia coli [TaxId:562] [57828] (46 PDB entries)
   Uniprot P00478

8. Domain d2fzkb2: 2fzk B:101-153 [134452]
   Other proteins in same PDB: d2fzka1, d2fzka2, d2fzkb1, d2fzkc1, d2fzkc2, d2fzkd1
   automatically matched to d1acmb2
   complexed with ctp, eoz, zn

Details for d2fzkb2

PDB Entry: 2fzk, 2.5 Å

PDB Description: The Structure of Wild-Type E. Coli Aspartate Transcarbamoylase in Complex with Novel T State Inhibitors at 2.50 Resolution

PDB Compounds: (B:) Aspartate carbamoyltransferase regulatory chain

SCOP Domain Sequences for d2fzkb2:

Sequence; same for both SEQRES and ATOM records:

>d2fzkb2 g.41.7.1 (B:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

Timeline for d2fzkb2:

• d2fzkb2 first appeared in SCOP 1.73
  
• d2fzkb2 appears in SCOPe 2.01
  
• d2fzkb2 appears in the current release, SCOPe 2.08