Lineage for d2fzka2 (2fzk A:151-310)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2906432Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2906433Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2906434Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)
  6. 2906435Protein Aspartate carbamoyltransferase catalytic subunit [53673] (7 species)
  7. 2906443Species Escherichia coli [TaxId:562] [53674] (62 PDB entries)
    Uniprot P00479
  8. 2906551Domain d2fzka2: 2fzk A:151-310 [134450]
    Other proteins in same PDB: d2fzkb1, d2fzkb2, d2fzkd1, d2fzkd2
    automated match to d3csua2
    complexed with ctp, eoz, zn

Details for d2fzka2

PDB Entry: 2fzk (more details), 2.5 Å

PDB Description: The Structure of Wild-Type E. Coli Aspartate Transcarbamoylase in Complex with Novel T State Inhibitors at 2.50 Resolution
PDB Compounds: (A:) Aspartate carbamoyltransferase catalytic chain

SCOPe Domain Sequences for d2fzka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fzka2 c.78.1.1 (A:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]}
rldnlhvamvgdlkygrtvhsltqalakfdgnrfyfiapdalampqyildmldekgiaws
lhssieevmaevdilymtrvqkerldpseyanvkaqfvlrasdlhnakanmkvlhplprv
deiatdvdktphawyfqqagngifarqallalvlnrdlvl

SCOPe Domain Coordinates for d2fzka2:

Click to download the PDB-style file with coordinates for d2fzka2.
(The format of our PDB-style files is described here.)

Timeline for d2fzka2: