Lineage for d2fzia1 (2fzi A:1-206)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 843142Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 843143Superfamily c.71.1: Dihydrofolate reductase-like [53597] (2 families) (S)
  5. 843144Family c.71.1.1: Dihydrofolate reductases [53598] (3 proteins)
  6. 843259Protein Dihydrofolate reductases, eukaryotic type [53605] (4 species)
  7. 843269Species Fungus (Pneumocystis carinii) [TaxId:4754] [53608] (14 PDB entries)
  8. 843270Domain d2fzia1: 2fzi A:1-206 [134448]
    automatically matched to d1cd2a_
    complexed with dh3, nap

Details for d2fzia1

PDB Entry: 2fzi (more details), 1.6 Å

PDB Description: New Insights into DHFR Interactions: Analysis of Pneumocystis carinii and Mouse DHFR Complexes with NADPH and Two Highly Potent Trimethoprim Derivatives
PDB Compounds: (A:) dihydrofolate reductase

SCOP Domain Sequences for d2fzia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fzia1 c.71.1.1 (A:1-206) Dihydrofolate reductases, eukaryotic type {Fungus (Pneumocystis carinii) [TaxId: 4754]}
mnqqksltlivalttsygigrsnslpwklkkeisyfkrvtsfvptfdsfesmnvvlmgrk
twesiplqfrplkgrinvvitrnesldlgngihsaksldhalellyrtygsessvqinri
fviggaqlykaamdhpkldrimatiiykdihcdvffplkfrdkewssvwkkekhsdlesw
vgtkvphgkinedgfdyefemwtrdl

SCOP Domain Coordinates for d2fzia1:

Click to download the PDB-style file with coordinates for d2fzia1.
(The format of our PDB-style files is described here.)

Timeline for d2fzia1: