SCOP 1.75: Domain d2fzha1: 2fzh A:1-206

Lineage for d2fzha1 (2fzh A:1-206)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (2 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (3 proteins)

6. Protein Dihydrofolate reductases, eukaryotic type [53605] (4 species)

7. Species Fungus (Pneumocystis carinii) [TaxId:4754] [53608] (14 PDB entries)

8. Domain d2fzha1: 2fzh A:1-206 [134447]
   automatically matched to d1cd2a_
   complexed with dh1, nap

Details for d2fzha1

PDB Entry: 2fzh, 2.1 Å

PDB Description: New Insights into Dihydrofolate Reductase Interactions: Analysis of Pneumocystis carinii and Mouse DHFR Complexes with NADPH and Two Highly Potent Trimethoprim Derivatives

PDB Compounds: (A:) dihydrofolate reductase

SCOP Domain Sequences for d2fzha1:

Sequence; same for both SEQRES and ATOM records:

>d2fzha1 c.71.1.1 (A:1-206) Dihydrofolate reductases, eukaryotic type {Fungus (Pneumocystis carinii) [TaxId: 4754]}
mnqqksltlivalttsygigrsnslpwklkkeisyfkrvtsfvptfdsfesmnvvlmgrk
twesiplqfrplkgrinvvitrnesldlgngihsaksldhalellyrtygsessvqinri
fviggaqlykaamdhpkldrimatiiykdihcdvffplkfrdkewssvwkkekhsdlesw
vgtkvphgkinedgfdyefemwtrdl

Timeline for d2fzha1:

• d2fzha1 first appeared in SCOP 1.73
  
• d2fzha1 is called d2fzha_ in SCOPe 2.01
  
• d2fzha1 appears in the current release, SCOPe 2.08, called d2fzha_