![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
![]() | Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) ![]() |
![]() | Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins) |
![]() | Protein Dihydrofolate reductases, eukaryotic type [53605] (7 species) |
![]() | Species Fungus (Pneumocystis carinii) [TaxId:4754] [53608] (25 PDB entries) |
![]() | Domain d2fzha_: 2fzh A: [134447] automated match to d1cd2a_ complexed with dh1, ndp |
PDB Entry: 2fzh (more details), 2.1 Å
SCOPe Domain Sequences for d2fzha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fzha_ c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic type {Fungus (Pneumocystis carinii) [TaxId: 4754]} mnqqksltlivalttsygigrsnslpwklkkeisyfkrvtsfvptfdsfesmnvvlmgrk twesiplqfrplkgrinvvitrnesldlgngihsaksldhalellyrtygsessvqinri fviggaqlykaamdhpkldrimatiiykdihcdvffplkfrdkewssvwkkekhsdlesw vgtkvphgkinedgfdyefemwtrdl
Timeline for d2fzha_: