SCOPe 2.08: Domain d2fzha_: 2fzh A:

Lineage for d2fzha_ (2fzh A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)

6. Protein Dihydrofolate reductases, eukaryotic type [53605] (7 species)

7. Species Fungus (Pneumocystis carinii) [TaxId:4754] [53608] (25 PDB entries)

8. Domain d2fzha_: 2fzh A: [134447]
   automated match to d1cd2a_
   complexed with dh1, ndp

Details for d2fzha_

PDB Entry: 2fzh, 2.1 Å

PDB Description: New Insights into Dihydrofolate Reductase Interactions: Analysis of Pneumocystis carinii and Mouse DHFR Complexes with NADPH and Two Highly Potent Trimethoprim Derivatives

PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d2fzha_:

Sequence; same for both SEQRES and ATOM records:

>d2fzha_ c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic type {Fungus (Pneumocystis carinii) [TaxId: 4754]}
mnqqksltlivalttsygigrsnslpwklkkeisyfkrvtsfvptfdsfesmnvvlmgrk
twesiplqfrplkgrinvvitrnesldlgngihsaksldhalellyrtygsessvqinri
fviggaqlykaamdhpkldrimatiiykdihcdvffplkfrdkewssvwkkekhsdlesw
vgtkvphgkinedgfdyefemwtrdl

Timeline for d2fzha_:

• d2fzha_ first appeared in SCOP 1.73, called d2fzha1
  
• d2fzha_ appears in SCOPe 2.07