SCOPe 2.08: Domain d2fzeb2: 2fze B:163-338

Lineage for d2fzeb2 (2fze B:163-338)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (19 proteins)
   N-terminal all-beta domain defines family

6. Protein Alcohol dehydrogenase [51737] (9 species)

7. Species Human (Homo sapiens), different isozymes [TaxId:9606] [51739] (24 PDB entries)
   Uniprot P00326 ! Uniprot P00325 ! Uniprot P07327

8. Domain d2fzeb2: 2fze B:163-338 [134436]
   Other proteins in same PDB: d2fzea1, d2fzeb1
   automated match to d1m6ha2
   complexed with apr, k, po4, zn

Details for d2fzeb2

PDB Entry: 2fze, 1.9 Å

PDB Description: crystal structure of the binary complex of human glutathione-dependent formaldehyde dehydrogenase with adp-ribose

PDB Compounds: (B:) Alcohol dehydrogenase class III chi chain

SCOPe Domain Sequences for d2fzeb2:

Sequence; same for both SEQRES and ATOM records:

>d2fzeb2 c.2.1.1 (B:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]}
apldkvcllgcgistgygaavntaklepgsvcavfglggvglavimgckvagasriigvd
inkdkfarakefgatecinpqdfskpiqevliemtdggvdysfecignvkvmraaleach
kgwgvsvvvgvaasgeeiatrpfqlvtgrtwkgtafggwksvesvpklvseymskk

Timeline for d2fzeb2:

• d2fzeb2 first appeared in SCOP 1.73
  
• d2fzeb2 appears in SCOPe 2.07