Lineage for d2fzeb1 (2fze B:1-162,B:339-373)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785352Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 2785353Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. 2785485Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 2785506Protein Alcohol dehydrogenase [50137] (9 species)
    contains a Zn-finger subdomain, residues 94-117
  7. 2785641Species Human (Homo sapiens), different isozymes [TaxId:9606] [50139] (24 PDB entries)
    Uniprot P00326 ! Uniprot P00325 ! Uniprot P07327
  8. 2785663Domain d2fzeb1: 2fze B:1-162,B:339-373 [134435]
    Other proteins in same PDB: d2fzea2, d2fzeb2
    automated match to d1m6ha1
    complexed with apr, k, po4, zn

Details for d2fzeb1

PDB Entry: 2fze (more details), 1.9 Å

PDB Description: crystal structure of the binary complex of human glutathione-dependent formaldehyde dehydrogenase with adp-ribose
PDB Compounds: (B:) Alcohol dehydrogenase class III chi chain

SCOPe Domain Sequences for d2fzeb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fzeb1 b.35.1.2 (B:1-162,B:339-373) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]}
anevikckaavaweagkplsieeievappkahevrikiiatavchtdaytlsgadpegcf
pvilghegagivesvgegvtklkagdtviplyipqcgeckfclnpktnlcqkirvtqgkg
lmpdgtsrftckgktilhymgtstfseytvvadisvakidplXikvdefvthnlsfdein
kafelmhsgksirtvvki

SCOPe Domain Coordinates for d2fzeb1:

Click to download the PDB-style file with coordinates for d2fzeb1.
(The format of our PDB-style files is described here.)

Timeline for d2fzeb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fzeb2