Lineage for d2fzcd2 (2fzc D:101-153)

  1. Root: SCOPe 2.06
  2. 2229111Class g: Small proteins [56992] (94 folds)
  3. 2235033Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2235504Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (2 families) (S)
    automatically mapped to Pfam PF02748
  5. 2235505Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)
  6. 2235506Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (3 species)
  7. 2235507Species Escherichia coli [TaxId:562] [57828] (60 PDB entries)
    Uniprot P00478
  8. 2235517Domain d2fzcd2: 2fzc D:101-153 [134431]
    Other proteins in same PDB: d2fzca1, d2fzca2, d2fzcb1, d2fzcc1, d2fzcc2, d2fzcd1
    automated match to d1d09b2
    complexed with ctp, eop, zn

Details for d2fzcd2

PDB Entry: 2fzc (more details), 2.1 Å

PDB Description: The Structure of Wild-Type E. Coli Aspartate Transcarbamoylase in Complex with Novel T State Inhibitors at 2.10 Resolution
PDB Compounds: (D:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d2fzcd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fzcd2 g.41.7.1 (D:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

SCOPe Domain Coordinates for d2fzcd2:

Click to download the PDB-style file with coordinates for d2fzcd2.
(The format of our PDB-style files is described here.)

Timeline for d2fzcd2: