Lineage for d2fzcd1 (2fzc D:2-100)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 861263Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (1 family) (S)
  5. 861264Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)
  6. 861265Protein Aspartate carbamoyltransferase [54895] (2 species)
  7. 861269Species Escherichia coli [TaxId:562] [54896] (46 PDB entries)
    Uniprot P00478
  8. 861271Domain d2fzcd1: 2fzc D:2-100 [134430]
    Other proteins in same PDB: d2fzca1, d2fzca2, d2fzcb2, d2fzcc1, d2fzcc2, d2fzcd2
    automatically matched to d1d09b1
    complexed with ctp, eop, zn

Details for d2fzcd1

PDB Entry: 2fzc (more details), 2.1 Å

PDB Description: The Structure of Wild-Type E. Coli Aspartate Transcarbamoylase in Complex with Novel T State Inhibitors at 2.10 Resolution
PDB Compounds: (D:) Aspartate carbamoyltransferase regulatory chain

SCOP Domain Sequences for d2fzcd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fzcd1 d.58.2.1 (D:2-100) Aspartate carbamoyltransferase {Escherichia coli [TaxId: 562]}
thdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdliki
entflsedqvdqlalyapqatvnridnyevvgksrpslp

SCOP Domain Coordinates for d2fzcd1:

Click to download the PDB-style file with coordinates for d2fzcd1.
(The format of our PDB-style files is described here.)

Timeline for d2fzcd1: