SCOPe 2.07: Domain d2fzcc1: 2fzc C:1-150

Lineage for d2fzcc1 (2fzc C:1-150)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)

5. Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)

6. Protein Aspartate carbamoyltransferase catalytic subunit [53673] (7 species)

7. Species Escherichia coli [TaxId:562] [53674] (63 PDB entries)
   Uniprot P00479

8. Domain d2fzcc1: 2fzc C:1-150 [134428]
   Other proteins in same PDB: d2fzcb1, d2fzcb2, d2fzcd1, d2fzcd2
   automated match to d3csua1
   complexed with ctp, eop, zn

Details for d2fzcc1

PDB Entry: 2fzc, 2.1 Å

PDB Description: The Structure of Wild-Type E. Coli Aspartate Transcarbamoylase in Complex with Novel T State Inhibitors at 2.10 Resolution

PDB Compounds: (C:) Aspartate carbamoyltransferase catalytic chain

SCOPe Domain Sequences for d2fzcc1:

Sequence; same for both SEQRES and ATOM records:

>d2fzcc1 c.78.1.1 (C:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]}
anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
nvpvlnagdgsnqhptqtlldlftiqetqg

Timeline for d2fzcc1:

• d2fzcc1 first appeared in SCOP 1.73
  
• d2fzcc1 appears in SCOPe 2.06
  
• d2fzcc1 appears in the current release, SCOPe 2.08