Lineage for d2fzcc1 (2fzc C:1-150)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1386472Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 1386473Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 1386474Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)
  6. 1386475Protein Aspartate carbamoyltransferase catalytic subunit [53673] (6 species)
  7. 1386483Species Escherichia coli [TaxId:562] [53674] (62 PDB entries)
    Uniprot P00479
  8. 1386522Domain d2fzcc1: 2fzc C:1-150 [134428]
    Other proteins in same PDB: d2fzcb1, d2fzcb2, d2fzcd1, d2fzcd2
    automated match to d3csua1
    complexed with ctp, eop, zn

Details for d2fzcc1

PDB Entry: 2fzc (more details), 2.1 Å

PDB Description: The Structure of Wild-Type E. Coli Aspartate Transcarbamoylase in Complex with Novel T State Inhibitors at 2.10 Resolution
PDB Compounds: (C:) Aspartate carbamoyltransferase catalytic chain

SCOPe Domain Sequences for d2fzcc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fzcc1 c.78.1.1 (C:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]}
anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
nvpvlnagdgsnqhptqtlldlftiqetqg

SCOPe Domain Coordinates for d2fzcc1:

Click to download the PDB-style file with coordinates for d2fzcc1.
(The format of our PDB-style files is described here.)

Timeline for d2fzcc1: