SCOP 1.75: Domain d2fzca2: 2fzc A:151-310

Lineage for d2fzca2 (2fzc A:151-310)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family)

5. Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (3 proteins)

6. Protein Aspartate carbamoyltransferase catalytic subunit [53673] (4 species)

7. Species Escherichia coli [TaxId:562] [53674] (50 PDB entries)
   Uniprot P00479

8. Domain d2fzca2: 2fzc A:151-310 [134425]
   Other proteins in same PDB: d2fzcb1, d2fzcb2, d2fzcd1, d2fzcd2
   automatically matched to d1ekxa2
   complexed with ctp, eop, zn

Details for d2fzca2

PDB Entry: 2fzc, 2.1 Å

PDB Description: The Structure of Wild-Type E. Coli Aspartate Transcarbamoylase in Complex with Novel T State Inhibitors at 2.10 Resolution

PDB Compounds: (A:) Aspartate carbamoyltransferase catalytic chain

SCOP Domain Sequences for d2fzca2:

Sequence; same for both SEQRES and ATOM records:

>d2fzca2 c.78.1.1 (A:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]}
rldnlhvamvgdlkygrtvhsltqalakfdgnrfyfiapdalampqyildmldekgiaws
lhssieevmaevdilymtrvqkerldpseyanvkaqfvlrasdlhnakanmkvlhplprv
deiatdvdktphawyfqqagngifarqallalvlnrdlvl

Timeline for d2fzca2:

• d2fzca2 first appeared in SCOP 1.73
  
• d2fzca2 appears in SCOPe 2.01
  
• d2fzca2 appears in the current release, SCOPe 2.08