SCOPe 2.07: Domain d2fz5a1: 2fz5 A:1-137

Lineage for d2fz5a1 (2fz5 A:1-137)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.1: Flavodoxin-related [52219] (6 protein domains)
   binds FMN

6. Protein Flavodoxin [52220] (10 species)

7. Species Megasphaera elsdenii [TaxId:907] [142045] (1 PDB entry)
   Uniprot P00321 1-137

8. Domain d2fz5a1: 2fz5 A:1-137 [134420]
   complexed with fnr

Details for d2fz5a1

PDB Entry: 2fz5

PDB Description: Solution structure of two-electron reduced Megasphaera elsdenii flavodoxin

PDB Compounds: (A:) flavodoxin

SCOPe Domain Sequences for d2fz5a1:

Sequence; same for both SEQRES and ATOM records:

>d2fz5a1 c.23.5.1 (A:1-137) Flavodoxin {Megasphaera elsdenii [TaxId: 907]}
mveivywsgtgnteamaneieaavkaagadvesvrfedtnvddvaskdvillgcpamgse
eledsvvepfftdlapklkgkkvglfgsygwgsgewmdawkqrtedtgatvigtaivnem
pdnapeckelgeaaaka

Timeline for d2fz5a1:

• d2fz5a1 first appeared in SCOP 1.73
  
• d2fz5a1 appears in SCOPe 2.06