![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.5: Flavoproteins [52218] (9 families) ![]() |
![]() | Family c.23.5.1: Flavodoxin-related [52219] (6 proteins) binds FMN |
![]() | Protein Flavodoxin [52220] (11 species) |
![]() | Species Megasphaera elsdenii [TaxId:907] [142045] (1 PDB entry) Uniprot P00321 1-137 |
![]() | Domain d2fz5a1: 2fz5 A:1-137 [134420] complexed with fnr |
PDB Entry: 2fz5 (more details)
SCOPe Domain Sequences for d2fz5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fz5a1 c.23.5.1 (A:1-137) Flavodoxin {Megasphaera elsdenii [TaxId: 907]} mveivywsgtgnteamaneieaavkaagadvesvrfedtnvddvaskdvillgcpamgse eledsvvepfftdlapklkgkkvglfgsygwgsgewmdawkqrtedtgatvigtaivnem pdnapeckelgeaaaka
Timeline for d2fz5a1: