Lineage for d2fz5a1 (2fz5 A:1-137)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2856357Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2856358Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
    binds FMN
  6. 2856359Protein Flavodoxin [52220] (11 species)
  7. 2856432Species Megasphaera elsdenii [TaxId:907] [142045] (1 PDB entry)
    Uniprot P00321 1-137
  8. 2856433Domain d2fz5a1: 2fz5 A:1-137 [134420]
    complexed with fnr

Details for d2fz5a1

PDB Entry: 2fz5 (more details)

PDB Description: solution structure of two-electron reduced megasphaera elsdenii flavodoxin
PDB Compounds: (A:) flavodoxin

SCOPe Domain Sequences for d2fz5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fz5a1 c.23.5.1 (A:1-137) Flavodoxin {Megasphaera elsdenii [TaxId: 907]}
mveivywsgtgnteamaneieaavkaagadvesvrfedtnvddvaskdvillgcpamgse
eledsvvepfftdlapklkgkkvglfgsygwgsgewmdawkqrtedtgatvigtaivnem
pdnapeckelgeaaaka

SCOPe Domain Coordinates for d2fz5a1:

Click to download the PDB-style file with coordinates for d2fz5a1.
(The format of our PDB-style files is described here.)

Timeline for d2fz5a1: