![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (55 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.57: Transposase IS200-like [143422] (1 family) ![]() contains extra N-terminal hairpin and C-terminal helix, both are involved in dimerization; there can be helix-swapping in the dimer |
![]() | Family d.58.57.1: Transposase IS200-like [143423] (3 proteins) Pfam PF01797 |
![]() | Protein Putative transposase DR0177 [143428] (1 species) |
![]() | Species Deinococcus radiodurans [TaxId:1299] [143429] (1 PDB entry) |
![]() | Domain d2fyxb1: 2fyx B:1-130 [134412] automatically matched to 2FYX A:1-130 complexed with gol |
PDB Entry: 2fyx (more details), 1.9 Å
SCOP Domain Sequences for d2fyxb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fyxb1 d.58.57.1 (B:1-130) Putative transposase DR0177 {Deinococcus radiodurans [TaxId: 1299]} mkkgrgyvykleyhliwatkyrhqvlvdevadglkdilrdiatqnglelvalevmpdyvh lllgatpqhvipdfvkalkgasarrmfsafphlkqphwggnlwnpsycvltvsehtraqi qqyienqhaa
Timeline for d2fyxb1: