Lineage for d2fyxb1 (2fyx B:1-130)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 726192Superfamily d.58.57: Transposase IS200-like [143422] (1 family) (S)
    contains extra N-terminal hairpin and C-terminal helix, both are involved in dimerization; there can be helix-swapping in the dimer
  5. 726193Family d.58.57.1: Transposase IS200-like [143423] (3 proteins)
    Pfam PF01797
  6. 726200Protein Putative transposase DR0177 [143428] (1 species)
  7. 726201Species Deinococcus radiodurans [TaxId:1299] [143429] (1 PDB entry)
  8. 726203Domain d2fyxb1: 2fyx B:1-130 [134412]
    automatically matched to 2FYX A:1-130
    complexed with gol

Details for d2fyxb1

PDB Entry: 2fyx (more details), 1.9 Å

PDB Description: crystal structure of a putative transposase (dr_0177) from deinococcus radiodurans r1 at 1.90 a resolution
PDB Compounds: (B:) Transposase, putative

SCOP Domain Sequences for d2fyxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fyxb1 d.58.57.1 (B:1-130) Putative transposase DR0177 {Deinococcus radiodurans [TaxId: 1299]}
mkkgrgyvykleyhliwatkyrhqvlvdevadglkdilrdiatqnglelvalevmpdyvh
lllgatpqhvipdfvkalkgasarrmfsafphlkqphwggnlwnpsycvltvsehtraqi
qqyienqhaa

SCOP Domain Coordinates for d2fyxb1:

Click to download the PDB-style file with coordinates for d2fyxb1.
(The format of our PDB-style files is described here.)

Timeline for d2fyxb1: