| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.57: Transposase IS200-like [143422] (1 family) ![]() contains extra N-terminal hairpin and C-terminal helix, both are involved in dimerization; there can be helix-swapping in the dimer automatically mapped to Pfam PF01797 |
| Family d.58.57.1: Transposase IS200-like [143423] (4 proteins) Pfam PF01797 |
| Protein Putative transposase DR0177 [143428] (1 species) |
| Species Deinococcus radiodurans [TaxId:1299] [143429] (1 PDB entry) Uniprot Q9RXX8 1-130 |
| Domain d2fyxa1: 2fyx A:2-130 [134411] Other proteins in same PDB: d2fyxa2, d2fyxb3 complexed with gol |
PDB Entry: 2fyx (more details), 1.9 Å
SCOPe Domain Sequences for d2fyxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fyxa1 d.58.57.1 (A:2-130) Putative transposase DR0177 {Deinococcus radiodurans [TaxId: 1299]}
kkgrgyvykleyhliwatkyrhqvlvdevadglkdilrdiatqnglelvalevmpdyvhl
llgatpqhvipdfvkalkgasarrmfsafphlkqphwggnlwnpsycvltvsehtraqiq
qyienqhaa
Timeline for d2fyxa1: