SCOP 1.75: Domain d2fyxa1: 2fyx A:1-130

Lineage for d2fyxa1 (2fyx A:1-130)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.57: Transposase IS200-like [143422] (1 family)
   contains extra N-terminal hairpin and C-terminal helix, both are involved in dimerization; there can be helix-swapping in the dimer

5. Family d.58.57.1: Transposase IS200-like [143423] (3 proteins)
   Pfam PF01797

6. Protein Putative transposase DR0177 [143428] (1 species)

7. Species Deinococcus radiodurans [TaxId:1299] [143429] (1 PDB entry)
   Uniprot Q9RXX8 1-130

8. Domain d2fyxa1: 2fyx A:1-130 [134411]
   complexed with gol

Details for d2fyxa1

PDB Entry: 2fyx, 1.9 Å

PDB Description: crystal structure of a putative transposase (dr_0177) from deinococcus radiodurans r1 at 1.90 a resolution

PDB Compounds: (A:) Transposase, putative

SCOP Domain Sequences for d2fyxa1:

Sequence; same for both SEQRES and ATOM records:

>d2fyxa1 d.58.57.1 (A:1-130) Putative transposase DR0177 {Deinococcus radiodurans [TaxId: 1299]}
mkkgrgyvykleyhliwatkyrhqvlvdevadglkdilrdiatqnglelvalevmpdyvh
lllgatpqhvipdfvkalkgasarrmfsafphlkqphwggnlwnpsycvltvsehtraqi
qqyienqhaa

Timeline for d2fyxa1:

• d2fyxa1 first appeared in SCOP 1.73
  
• d2fyxa1 appears in SCOPe 2.01
  
• d2fyxa1 appears in the current release, SCOPe 2.08