Lineage for d2fywc1 (2fyw C:1-265)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 713572Fold c.135: NIF3 (NGG1p interacting factor 3)-like [102704] (1 superfamily)
    consist of two intertwined domains; duplication: contains two structural repeats of alpha-beta-(beta-alpha)3 motif with mixed beta-sheet, order: 1432, strand 1 is antiparallel to the rest
  4. 713573Superfamily c.135.1: NIF3 (NGG1p interacting factor 3)-like [102705] (1 family) (S)
    di-iron binding protein
  5. 713574Family c.135.1.1: NIF3 (NGG1p interacting factor 3)-like [102706] (3 proteins)
    Pfam PF01784
  6. 713575Protein Hypothetical protein SP1609 [142820] (1 species)
  7. 713576Species Streptococcus pneumoniae [TaxId:1313] [142821] (1 PDB entry)
  8. 713579Domain d2fywc1: 2fyw C:1-265 [134410]
    automatically matched to 2FYW A:1-265

Details for d2fywc1

PDB Entry: 2fyw (more details), 2.4 Å

PDB Description: Crystal Structure of a Conserved Protein of Unknown Function from Streptococcus pneumoniae
PDB Compounds: (C:) conserved hypothetical protein

SCOP Domain Sequences for d2fywc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fywc1 c.135.1.1 (C:1-265) Hypothetical protein SP1609 {Streptococcus pneumoniae [TaxId: 1313]}
mlaseviqayeafcpqefsmegdsrglqigtldkgiqrvmvaldireetvaeaiekgvdl
iivkhapifrpikdllasrpqnqiyidlikhdiavyvshtnidivenglndwfcqmlgie
ettylqetgpergigrigniqpqtfwelaqqvkqvfdldslrmvhyqeddlqkpisrvai
cggsgqsfykdalakgadvyitgdiyyhtaqdmlsdgllaldpghyievifvekiaalls
qwkedkgwsidilpsqastnpfhhi

SCOP Domain Coordinates for d2fywc1:

Click to download the PDB-style file with coordinates for d2fywc1.
(The format of our PDB-style files is described here.)

Timeline for d2fywc1: