SCOPe 2.07: Domain d2fywb2: 2fyw B:1-265

Lineage for d2fywb2 (2fyw B:1-265)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.135: NIF3 (NGG1p interacting factor 3)-like [102704] (1 superfamily)
   consist of two intertwined domains; duplication: contains two structural repeats of alpha-beta-(beta-alpha)3 motif with mixed beta-sheet, order: 1432, strand 1 is antiparallel to the rest

4. Superfamily c.135.1: NIF3 (NGG1p interacting factor 3)-like [102705] (2 families)
   di-iron binding protein

5. Family c.135.1.1: NIF3 (NGG1p interacting factor 3)-like [102706] (3 proteins)
   Pfam PF01784

6. Protein Hypothetical protein SP1609 [142820] (1 species)

7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [142821] (1 PDB entry)
   Uniprot Q97PK0 1-265

8. Domain d2fywb2: 2fyw B:1-265 [134409]
   Other proteins in same PDB: d2fywa2, d2fywb3, d2fywc3
   automated match to d2fywa1

Details for d2fywb2

PDB Entry: 2fyw, 2.4 Å

PDB Description: Crystal Structure of a Conserved Protein of Unknown Function from Streptococcus pneumoniae

PDB Compounds: (B:) conserved hypothetical protein

SCOPe Domain Sequences for d2fywb2:

Sequence; same for both SEQRES and ATOM records:

>d2fywb2 c.135.1.1 (B:1-265) Hypothetical protein SP1609 {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
mlaseviqayeafcpqefsmegdsrglqigtldkgiqrvmvaldireetvaeaiekgvdl
iivkhapifrpikdllasrpqnqiyidlikhdiavyvshtnidivenglndwfcqmlgie
ettylqetgpergigrigniqpqtfwelaqqvkqvfdldslrmvhyqeddlqkpisrvai
cggsgqsfykdalakgadvyitgdiyyhtaqdmlsdgllaldpghyievifvekiaalls
qwkedkgwsidilpsqastnpfhhi

Timeline for d2fywb2:

• d2fywb2 first appeared in SCOP 1.73, called d2fywb1
  
• d2fywb2 appears in SCOPe 2.06
  
• d2fywb2 appears in the current release, SCOPe 2.08