![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.135: NIF3 (NGG1p interacting factor 3)-like [102704] (1 superfamily) consist of two intertwined domains; duplication: contains two structural repeats of alpha-beta-(beta-alpha)3 motif with mixed beta-sheet, order: 1432, strand 1 is antiparallel to the rest |
![]() | Superfamily c.135.1: NIF3 (NGG1p interacting factor 3)-like [102705] (1 family) ![]() di-iron binding protein |
![]() | Family c.135.1.1: NIF3 (NGG1p interacting factor 3)-like [102706] (3 proteins) Pfam PF01784 |
![]() | Protein Hypothetical protein SP1609 [142820] (1 species) |
![]() | Species Streptococcus pneumoniae [TaxId:1313] [142821] (1 PDB entry) |
![]() | Domain d2fywa1: 2fyw A:1-265 [134408] |
PDB Entry: 2fyw (more details), 2.4 Å
SCOP Domain Sequences for d2fywa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fywa1 c.135.1.1 (A:1-265) Hypothetical protein SP1609 {Streptococcus pneumoniae [TaxId: 1313]} mlaseviqayeafcpqefsmegdsrglqigtldkgiqrvmvaldireetvaeaiekgvdl iivkhapifrpikdllasrpqnqiyidlikhdiavyvshtnidivenglndwfcqmlgie ettylqetgpergigrigniqpqtfwelaqqvkqvfdldslrmvhyqeddlqkpisrvai cggsgqsfykdalakgadvyitgdiyyhtaqdmlsdgllaldpghyievifvekiaalls qwkedkgwsidilpsqastnpfhhi
Timeline for d2fywa1: