![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.184: Non-globular alpha+beta subunits of globular proteins [56567] (1 superfamily) not a true fold |
![]() | Superfamily d.184.1: Non-globular alpha+beta subunits of globular proteins [56568] (4 families) ![]() not a true superfamily |
![]() | Family d.184.1.3: Ubiquinol-cytochrome c reductase 8 kDa protein [90077] (2 proteins) beta-hairpin and a short alpha-helix bound to the core subunits |
![]() | Protein Ubiquinol-cytochrome c reductase 8 kDa protein [90078] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [90079] (15 PDB entries) there are other PDB entries with lower resolution structures of the Ubiquinol-cytochrome c reductase complex, in which this subunit has incomplete and probably mistraced structure that is not classified in scop Uniprot P13272 1-57 ! Uniprot P13272 |
![]() | Domain d2fyui_: 2fyu I: [134403] Other proteins in same PDB: d2fyua1, d2fyua2, d2fyub1, d2fyub2, d2fyuc1, d2fyuc2, d2fyud1, d2fyud2, d2fyue1, d2fyue2, d2fyuf_, d2fyug_, d2fyuh_, d2fyuj_, d2fyuk_ automated match to d1l0li_ complexed with fdn, fes, hem |
PDB Entry: 2fyu (more details), 2.26 Å
SCOPe Domain Sequences for d2fyui_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fyui_ d.184.1.3 (I:) Ubiquinol-cytochrome c reductase 8 kDa protein {Cow (Bos taurus) [TaxId: 9913]} mlsvaarsgpfapvlsatsrgvagalrplvqaavpatsespvldlkrsvlcreslrg
Timeline for d2fyui_: